-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Mras was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 109-208 of human Mras (O14807) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Mras was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 109-208 of human Mras (O14807) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13409A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRAS |
| Target Synonyms | NS11; M-RAs; RRAS3; R-RAS3; Mras | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Mouse kidney, Rat brain, Mouse brain, Mouse lung, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 109-208 of human Mras (O14807). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL | Uniprot ID | O14807 |
Uniprot Id
O14807
Target Species
Human
Target Name
MRAS
Target Full Name
Ras-related protein M-Ras
Target Function
Serves as an important signal transducer for a novel upstream stimuli in controlling cell proliferation. Activates the MAP kinase pathway.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, Ras family
Target Tissue Specificity
Expression highly restricted to the brain and heart.
Target Research Area
Cancer
Target Synonyms
FLJ42964; M ras; M-ras; Mras; Muscle and microspikes Ras; Muscle RAS oncogene homolog; Muscle Ras oncogene homologue; Muscle Ras viral oncogene homolog; R ras3; R-ras3; Ras related protein MRas; Ras related protein RRas3; Ras-related protein M-Ras; Ras-related protein R-Ras3; RASM_HUMAN; Related Ras viral oncogene homolog 3; RRas3; XRas
Target Background
This gene encodes a member of the Ras family of small GTPases. These membrane-associated proteins function as signal transducers in multiple processes including cell growth and differentiation, and dysregulation of Ras signaling has been associated with many types of cancer. The encoded protein may play a role in the tumor necrosis factor-alpha and MAP kinase signaling pathways. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification