-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL11RA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 323-422 of human IL11RA (Q14626) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IL11RA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 323-422 of human IL11RA (Q14626) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13414A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL11RA |
| Target Synonyms | CRSDA; IL11RA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, K-562, TF-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 323-422 of human IL11RA (Q14626). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAPNL | Uniprot ID | Q14626 |
Uniprot Id
Q14626
Target Species
Human
Target Name
IL11RA
Target Full Name
Interleukin-11 receptor subunit alpha
Target Function
Receptor for interleukin-11 (IL11). The receptor systems for IL6, LIF, OSM, CNTF, IL11 and CT1 can utilize IL6ST for initiating signal transmission. The IL11/IL11RA/IL6ST complex may be involved in the control of proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells (Probable). Essential for the normal development of craniofacial bones and teeth. Restricts suture fusion and tooth number.; Soluble form of IL11 receptor (sIL11RA) that acts as an agonist of IL11 activity. The IL11:sIL11RA complex binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL11RA in a process called IL11 trans-signaling.; Soluble form of IL11 receptor (sIL11RA) that acts as an agonist of IL11 activity. The IL11:sIL11RA complex binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL11RA in a process called IL11 trans-signaling.
Target Involvement
Craniosynostosis and dental anomalies (CRSDA)
Target Subcellular Location
[Interleukin-11 receptor subunit alpha]: Membrane; Single-pass type I membrane protein.; [Soluble interleukin-11 receptor subunit alpha]: Secreted.; [Isoform HCR2]: Secreted.
Target Protein Families
Type I cytokine receptor family, Type 3 subfamily
Target Tissue Specificity
Expressed in a number of cell lines, including the myelogenous leukemia cell line K-562, the megakaryocytic leukemia cell line M-07e, the erythroleukemia cell line TF-1, and the osteosarcoma cell lines, MG-63 and SaOS-2. Also expressed in normal and malig
Target Synonyms
CRSDA; hCG_2011440; I11RA_HUMAN; IL-11 receptor subunit alpha; IL-11R subunit alpha; IL-11R-alpha; IL-11RA; IL11RA; Interleukin 11 receptor alpha ; Interleukin 11 receptor alpha chain; Interleukin-11 receptor subunit alpha; MGC2146
Target Background
Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain. Multiple alternatively spliced transcript variants have been found for this gene.
Notification