Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOCS7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SOCS7 (NP_055413.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against SOCS7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SOCS7 (NP_055413.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of SOCS7 in paraffin-embedded human brain using SOCS7 Rabbit mAb at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-13431A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOCS7 |
| Target Synonyms | NAP4; NCKAP4; SOCS7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SOCS7 (NP_055413.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAA | Uniprot ID | O14512 |
Uniprot Id
O14512
Target Species
Human
Target Name
SOCS7
Target Full Name
Suppressor of cytokine signaling 7
Target Function
Regulates signaling cascades probably through protein ubiquitination and/or sequestration. Functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. Inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. May be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus. Note=Mostly cytoplasmic, but shuttles between the cytoplasm and the nucleus. Rapidly relocalizes to the nucleus after UV irradiation. Cytoplasmic location depends upon SEPT7 presence.
Target Tissue Specificity
Expressed in brain and leukocytes. Also in fetal lung fibroblasts and fetal brain.
Target Synonyms
Ash and phospholipase C gamma-binding protein; NAP 4; NAP 4 Fragment; NAP-4; NAP4; Nck; Nck Ash and phospholipase C binding protein; Nck Ash and phospholipase C gamma binding protein; Nck associated protein 4; Nck-associated protein 4; NCKAP4; SH2 domain containing SOCS box protein; SOCS 7; SOCS-7; SOCS4; SOCS6; Socs7; SOCS7_HUMAN; Suppressor of cytokine signaling 7
Target Background
Predicted to enable 1-phosphatidylinositol-3-kinase regulator activity. Predicted to be involved in phosphatidylinositol phosphate biosynthetic process. Predicted to act upstream of or within several processes, including brain development; fat cell differentiation; and insulin receptor signaling pathway. Located in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
