-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 158-257 of human MRPS15 (P82914) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MRPS15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 158-257 of human MRPS15 (P82914) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13436A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS15 |
| Target Synonyms | DC37; S15mt; RPMS15; MPR-S15; MRPS15 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Cal-27, DU145, RD | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 158-257 of human MRPS15 (P82914). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ | Uniprot ID | P82914 |
Uniprot Id
P82914
Target Species
Human
Target Name
MRPS15
Target Full Name
Small ribosomal subunit protein uS15m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Universal ribosomal protein uS15 family
Target Synonyms
28S ribosomal protein S15; 28S ribosomal protein S15, mitochondrial [Precursor]; DC37; FLJ11564; mitochondrial; mitochondrial ribosomal protein S15; MPR S15; MRP-S15; MRPS15; RPMS15; RT15_HUMAN; S15mt
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
Notification