-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DROSHA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DROSHA (Q9NRR4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DROSHA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DROSHA (Q9NRR4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13604A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DROSHA |
| Target Synonyms | RN3; ETOHI2; RNASEN; RANSE3L; RNASE3L; HSA242976; DROSHA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2, Jurkat | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DROSHA (Q9NRR4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMQGNTCHRMSFHPGRGCPRGRGGHGARPSAPSFRPQNLRLLHPQQPPVQYQYEPPSAPSTTFSNSPAPNFLPPRPDFVPFPPPMPPSAQGPLPPCPIRP | Uniprot ID | Q9NRR4 |
Uniprot Id
Q9NRR4
Target Species
Human
Target Name
DROSHA
Target Full Name
Ribonuclease 3
Target Function
Ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus. Within the microprocessor complex, DROSHA cleaves the 3' and 5' strands of a stem-loop in pri-miRNAs (processing center 11 bp from the dsRNA-ssRNA junction) to release hairpin-shaped pre-miRNAs that are subsequently cut by the cytoplasmic DICER to generate mature miRNAs. Involved also in pre-rRNA processing. Cleaves double-strand RNA and does not cleave single-strand RNA. Involved in the formation of GW bodies.
Target Subcellular Location
Nucleus. Nucleus, nucleolus.
Target Protein Families
Ribonuclease III family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
DROSHA; Drosha double stranded RNA specific endoribonuclease; Drosha ribonuclease type III; Etohi2; HSA242976; Nuclear RNase III Drosha; p241; Protein Drosha; Putative protein p241 which interacts with transcription factor Sp1; Putative ribonuclease III; RANSE3L; Ribonuclease 3; Ribonuclease III; Ribonuclease III nuclear; Ribonuclease type III nuclear; RibonucleaseIII; RN 3; RN3; RNase 3; RNase III; RNase3; RNASE3L; RNaseIII; RNASEN; RNC_HUMAN
Target Background
This gene encodes a ribonuclease (RNase) III double-stranded RNA-specific ribonuclease and subunit of the microprocessor protein complex, which catalyzes the initial processing step of microRNA (miRNA) synthesis. The encoded protein cleaves the stem loop structure from the primary microRNA (pri-miRNA) in the nucleus, yielding the precursor miRNA (pre-miRNA), which is then exported to the cytoplasm for further processing. In a human cell line lacking a functional copy of this gene, canonical miRNA synthesis is reduced. Somatic mutations in this gene have been observed in human patients with kidney cancer.
Notification