-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AP2M1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human AP2M1 (Q96CW1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AP2M1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human AP2M1 (Q96CW1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13745A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AP2M1 |
| Target Synonyms | mu2; AP50; MRD60; CLAPM1; AP2M1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, HepG2, Mouse brain, Mouse liver, Mouse lung, Mouse spleen, Rat spleen, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AP2M1 (Q96CW1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLK | Uniprot ID | Q96CW1 |
Uniprot Id
Q96CW1
Target Species
Human
Target Name
AP2M1
Target Full Name
AP-2 complex subunit mu
Target Function
Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. During long-term potentiation in hippocampal neurons, AP-2 is responsible for the endocytosis of ADAM10. The AP-2 mu subunit binds to transmembrane cargo proteins; it recognizes the Y-X-X-Phi motifs. The surface region interacting with to the Y-X-X-Phi motif is inaccessible in cytosolic AP-2, but becomes accessible through a conformational change following phosphorylation of AP-2 mu subunit at Thr-156 in membrane-associated AP-2. The membrane-specific phosphorylation event appears to involve assembled clathrin which activates the AP-2 mu kinase AAK1. Plays a role in endocytosis of frizzled family members upon Wnt signaling.
Target Subcellular Location
Cell membrane. Membrane, coated pit; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Adaptor complexes medium subunit family
Target Tissue Specificity
Expressed in the brain (at protein level).
Target Research Area
Transport
Target Synonyms
Adapter-related protein complex 2 mu subunit; Adaptin mu 1; Adaptin-mu2; Adaptor protein complex AP 2 subunit mu; Adaptor protein complex AP-2 subunit mu; Adaptor related protein complex 2 mu 1 subunit; AP 2 mu 2 chain; AP-2 complex subunit mu; AP-2 mu chain; Ap2m1; AP2M1_HUMAN; AP50; CLAPM1; Clathrin adaptor complex AP2 mu subunit; Clathrin assembly protein complex 2 medium chain; Clathrin associated/assembly/adaptor protein medium 1; Clathrin coat adaptor protein AP50; Clathrin coat assembly protein AP50; Clathrin coat associated protein AP50; Clathrin coat-associated protein AP50; HA2 50 kDa subunit; mu2; Plasma membrane adaptor AP-2 50 kDa protein
Target Background
This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene.
Notification