Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Purinergic Receptor P2Y6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 229-328 of human Purinergic Receptor P2Y6 (Q15077) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Purinergic Receptor P2Y6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 229-328 of human Purinergic Receptor P2Y6 (Q15077) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13802A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Purinergic Receptor P2Y6 |
| Target Synonyms | P2Y6; Purinergic Receptor P2Y6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, U-87MG, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 229-328 of human Purinergic Receptor P2Y6 (Q15077). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR | Uniprot ID | Q15077 |
Uniprot Id
Q15077
Target Species
Human
Target Name
P2RY6
Target Full Name
P2Y purinoceptor 6
Target Function
Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
P2RY6; PP2891; P2Y purinoceptor 6; P2Y6
Target Background
The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor, which is a G-protein coupled receptor, is responsive to UDP, partially responsive to UTP and ADP, and not responsive to ATP. It is proposed that this receptor mediates inflammatory responses. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
