Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Calbindin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Calbindin (P05937) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Calbindin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Calbindin (P05937) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13840A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Calbindin |
| Target Synonyms | CALB; D-28K; Calbindin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Calbindin (P05937). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSC | Uniprot ID | P05937 |
Uniprot Id
P05937
Target Species
Human
Target Name
CALB1
Target Full Name
Calbindin
Target Function
Buffers cytosolic calcium. May stimulate a membrane Ca(2+)-ATPase and a 3',5'-cyclic nucleotide phosphodiesterase.
Target Protein Families
Calbindin family
Target Research Area
Others
Target Synonyms
avian-type; CAB27; CALB 1; CALB; CALB1; CALB1_HUMAN; Calbindin 1 28kDa; Calbindin; Calbindin D28; D 28K; D-28K; D28K; OTTHUMP00000166027; OTTHUMP00000225441; RTVL H protein; Vitamin D dependent calcium binding protein; Vitamin D dependent calcium binding protein avian type; Vitamin D-dependent calcium-binding protein
Target Background
The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
