-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF5A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF5A (P63241) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against eIF5A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF5A (P63241) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13862A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF5A |
| Target Synonyms | FABAS; EIF-5A; EIF5A1; eIF-4D; eIF5AI; eIF5A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HUVEC, Jurkat, Mouse pancreas, Mouse testis, Rat lung, Rat spleen, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF5A (P63241). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLS | Uniprot ID | P63241 |
Uniprot Id
P63241
Target Species
Human
Target Name
EIF5A
Target Full Name
Eukaryotic translation initiation factor 5A-1
Target Function
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.
Target Subcellular Location
Cytoplasm. Nucleus. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus, nuclear pore complex. Note=Hypusine modification promotes the nuclear export and cytoplasmic localization and there was a dynamic shift in the localization from predominantly cytoplasmic to primarily nuclear under apoptotic inducing conditions.
Target Protein Families
EIF-5A family
Target Tissue Specificity
Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).
Target Synonyms
eIF 4D; eIF 5A 1; EIF 5A; eIF 5A1; eIF-4D; eIF-5A; eIF-5A-1; eIF-5A1; eIF4D ; eif5a; EIF5A1; eIF5AI; Eukaryotic initiation factor 5A; Eukaryotic initiation factor 5A isoform 1; Eukaryotic translation initiation factor 5A 1; Eukaryotic translation initiation factor 5A; Eukaryotic translation initiation factor 5A-1; IF5A1_HUMAN; MGC104255; MGC99547; Rev binding factor; Rev-binding factor; uORF A; uORF
Target Background
Enables U6 snRNA binding activity and protein N-terminus binding activity. Involved in several processes, including cellular response to virus; positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator; and tumor necrosis factor-mediated signaling pathway. Located in annulate lamellae; cytoplasm; and nucleus. Part of nuclear pore.
Notification