-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against U2AF2/U2AF65 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 376-475 of human U2AF2/U2AF2/U2AF65 (P26368) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against U2AF2/U2AF65 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 376-475 of human U2AF2/U2AF2/U2AF65 (P26368) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-13879A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | U2AF2/U2AF65 |
| Target Synonyms | U2AF65; U2AF2/U2AF65 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HT-29, Mouse brain, Mouse lung | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 376-475 of human U2AF2/U2AF2/U2AF65 (P26368). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW | Uniprot ID | P26368 |
Uniprot Id
P26368
Target Species
Human
Target Name
U2AF2
Target Full Name
Splicing factor U2AF 65 kDa subunit
Target Function
Plays a role in pre-mRNA splicing and 3'-end processing. By recruiting PRPF19 and the PRP19C/Prp19 complex/NTC/Nineteen complex to the RNA polymerase II C-terminal domain (CTD), and thereby pre-mRNA, may couple transcription to splicing. Induces cardiac troponin-T (TNNT2) pre-mRNA exon inclusion in muscle. Regulates the TNNT2 exon 5 inclusion through competition with MBNL1. Binds preferentially to a single-stranded structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Required for the export of mRNA out of the nucleus, even if the mRNA is encoded by an intron-less gene. Represses the splicing of MAPT/Tau exon 10. Positively regulates pre-mRNA 3'-end processing by recruiting the CFIm complex to cleavage and polyadenylation signals.
Target Subcellular Location
Nucleus.
Target Protein Families
Splicing factor SR family
Target Research Area
Others
Target Synonyms
hU2AF(65); hU2AF65; Splicing factor U2AF 65 kDa subunit; U2 (RNU2) small nuclear RNA auxiliary factor 2; U2 auxiliary factor 65 kDa subunit; U2 small nuclear ribonucleoprotein auxiliary factor (65kD); U2 small nuclear RNA auxiliary factor 2; U2 snRNP auxiliary factor large subunit; U2af2; U2AF2_HUMAN; U2AF65
Target Background
U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date.
Notification