Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against K-Cadherin (CDH6) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 691-790 of human K-Cadherin (CDH6) (P55285) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against K-Cadherin (CDH6) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 691-790 of human K-Cadherin (CDH6) (P55285) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13904A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | K-Cadherin (CDH6) |
| Target Synonyms | CAD6; KCAD; K-Cadherin (CDH6) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Hep G2, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 691-790 of human K-Cadherin (CDH6) (P55285). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIVPEALFLPRRTPTARDNTDVRDFINQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADMYGGVDSDKDS | Uniprot ID | P55285 |
Uniprot Id
P55285
Target Species
Human
Target Name
CDH6
Target Full Name
Cadherin-6
Target Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression. Also expressed in certain liver and kidney carcinomas.
Target Synonyms
CDH6; Cadherin-6; Kidney cadherin; K-cadherin
Target Background
This gene encodes a member of the cadherin superfamily. Cadherins are membrane glycoproteins that mediate homophilic cell-cell adhesion and play critical roles in cell differentiation and morphogenesis. The encoded protein is a type II cadherin and may play a role in kidney development as well as endometrium and placenta formation. Decreased expression of this gene may be associated with tumor growth and metastasis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
