-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RNF20 (Q5VTR2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RNF20 (Q5VTR2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13911A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF20 |
| Target Synonyms | BRE1; BRE1A; hBRE1; RNF20 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, C2C12, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RNF20 (Q5VTR2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGIGNKRAAGEPGTSMPPEKKAAVEDSGTTVETIKLGGVSSTEELDIRTLQTKNRKLAEMLDQRQAIEDELREHIEKLERRQATDDASLLIVNRYWSQF | Uniprot ID | Q5VTR2 |
Uniprot Id
Q5VTR2
Target Species
Human
Target Name
RNF20
Target Full Name
E3 ubiquitin-protein ligase BRE1A
Target Function
Component of the RNF20/40 E3 ubiquitin-protein ligase complex that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). It thereby plays a central role inb histone code and gene regulation. The RNF20/40 complex forms a H2B ubiquitin ligase complex in cooperation with the E2 enzyme UBE2A or UBE2B; reports about the cooperation with UBE2E1/UBCH are contradictory. Required for transcriptional activation of Hox genes. Recruited to the MDM2 promoter, probably by being recruited by p53/TP53, and thereby acts as a transcriptional coactivator. Mediates the polyubiquitination of isoform 2 of PA2G4 in cancer cells leading to its proteasome-mediated degradation.
Target Subcellular Location
Nucleus.
Target Protein Families
BRE1 family
Target Tissue Specificity
Expressed in the normal brain and also in malignant gliomas (at protein level).
Target Synonyms
BRE1 A; BRE1; BRE1 E3 ubiquitin ligase homolog; BRE1-A; BRE1A; BRE1A_HUMAN; E3 ubiquitin-protein ligase BRE1A; hBRE1; Homolog of S. cerevisiae BRE1; RING finger protein 20; Ring finger protein 20 E3 ubiquitin protein ligase; Rnf20
Target Background
The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. The protein encoded by this human gene is an E3 ubiquitin ligase that regulates chromosome structure by monoubiquitinating histone H2B. This protein acts as a putative tumor suppressor and positively regulates the p53 tumor suppressor as well as numerous histone H2A and H2B genes. In contrast, this protein also suppresses the expression of several protooncogenes and growth-related genes, including many genes that are induced by epidermal growth factor. This gene selectively suppresses the expression of some genes by interfering with chromatin recruitment of transcription elongation factor SII (TFIIS).
Notification