Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BHMT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-406 of human BHMT (Q93088) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BHMT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-406 of human BHMT (Q93088) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13945A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BHMT |
| Target Synonyms | BHMT1; HEL-S-61p; BHMT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-406 of human BHMT (Q93088). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ | Uniprot ID | Q93088 |
Uniprot Id
Q93088
Target Species
Human
Target Name
BHMT
Target Full Name
Betaine--homocysteine S-methyltransferase 1
Target Function
Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Found exclusively in liver and kidney.
Target Synonyms
Betaine homocysteine methyltransferase; Betaine homocysteine S methyltransferase 1; Betaine homocysteine S methyltransferase; Betaine--homocysteine S-methyltransferase 1; BHMT; BHMT1; BHMT1_HUMAN; EC 2.1.1.5; Epididymis secretory sperm binding protein Li 61p; HEL S 61p
Target Background
This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
