-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Renin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Renin (P00797) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Renin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Renin (P00797) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13959A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Renin |
| Target Synonyms | RTD; HNFJ2; ADTKD4; Renin | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Renin (P00797). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFK | Uniprot ID | P00797 |
Uniprot Id
P00797
Target Species
Human
Target Name
REN
Target Full Name
Renin
Target Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Target Involvement
Renal tubular dysgenesis (RTD); Familial juvenile hyperuricemic nephropathy 2 (HNFJ2)
Target Subcellular Location
Secreted. Membrane. Note=Associated to membranes via binding to ATP6AP2.
Target Protein Families
Peptidase A1 family
Target Synonyms
Angiotensin forming enzyme; Angiotensin forming enzyme precursor ; Angiotensinogenase; Angiotensinogenase precursor; FLJ10761; HNFJ2; REN; Ren1; RENI_HUMAN; Renin; Renin precursor renal
Target Background
This gene encodes renin, an aspartic protease that is secreted by the kidneys. Renin is a part of the renin-angiotensin-aldosterone system involved in regulation of blood pressure, and electrolyte balance. This enzyme catalyzes the first step in the activation pathway of angiotensinogen by cleaving angiotensinogen to form angiotensin I, which is then converted to angiotensin II by angiotensin I converting enzyme. This cascade can result in aldosterone release, narrowing of blood vessels, and increase in blood pressure as angiotension II is a vasoconstrictive peptide. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause hyperuricemic nephropathy familial juvenile 2, familial hyperproreninemia, and renal tubular dysgenesis.
Notification