-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF2C/MCAK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF2C/KIF2C/MCAK (Q99661) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIF2C/MCAK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF2C/KIF2C/MCAK (Q99661) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14015A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF2C/MCAK |
| Target Synonyms | MCAK; CT139; KNSL6; KIF2C/MCAK | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, MCF7, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF2C/KIF2C/MCAK (Q99661). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI | Uniprot ID | Q99661 |
Uniprot Id
Q99661
Target Species
Human
Target Name
KIF2C
Target Full Name
Kinesin-like protein KIF2C
Target Function
In complex with KIF18B, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells. Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis. Plays a role in chromosome congression and is required for the lateral to end-on conversion of the chromosome-microtubule attachment.
Target Subcellular Location
Cytoplasm, cytoskeleton. Nucleus. Chromosome, centromere. Chromosome, centromere, kinetochore.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, MCAK/KIF2 subfamily
Target Tissue Specificity
Expressed at high levels in thymus and testis, at low levels in small intestine, the mucosal lining of colon, and placenta, and at very low levels in spleen and ovary; expression is not detected in prostate, peripheral blood Leukocytes, heart, brain, lung
Target Synonyms
4930402F02Rik; CT139; ESTM5; KIF 2C; kif2c; KIF2C_HUMAN; Kinesein Family Member 2C; Kinesin family member 2C; kinesin like 6 (mitotic centromere associated kinesin) ; Kinesin like 6; Kinesin like protein 6; Kinesin like protein KIF2C; Kinesin-like protein 6; Kinesin-like protein KIF2C; KNS L6; KNSL 6; KNSL6; MCAK; MGC11883; Mitotic centromere associated kinesin; Mitotic centromere-associated kinesin; OTTHUMP00000010066; X83316
Target Background
This gene encodes a kinesin-like protein that functions as a microtubule-dependent molecular motor. The encoded protein can depolymerize microtubules at the plus end, thereby promoting mitotic chromosome segregation. Alternative splicing results in multiple transcript variants.
Notification