-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STXBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human STXBP1 (P61764) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against STXBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human STXBP1 (P61764) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14029A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STXBP1 |
| Target Synonyms | P67; DEE4; NSEC1; UNC18; N-Sec1; RBSEC1; unc-18A; unc18-1; MUNC18-1; STXBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human STXBP1 (P61764). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYP | Uniprot ID | P61764 |
Uniprot Id
P61764
Target Species
Human
Target Name
STXBP1
Target Full Name
Syntaxin-binding protein 1
Target Function
Participates in the regulation of synaptic vesicle docking and fusion through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. May play a role in determining the specificity of intracellular fusion reactions.
Target Involvement
Epileptic encephalopathy, early infantile, 4 (EIEE4)
Target Subcellular Location
Cytoplasm, cytosol. Membrane; Peripheral membrane protein.
Target Protein Families
STXBP/unc-18/SEC1 family
Target Tissue Specificity
Brain and spinal cord. Highly enriched in axons.
Target Research Area
Cancer, Transport
Target Synonyms
FLJ37475; Munc 18 1; Munc 18a; MUNC18 1; N-Sec1; Neuronal SEC1; NSec1; p67; Protein unc-18 homolog 1; Protein unc-18 homolog A; Rb sec1; RBSEC1; STXB1_HUMAN; STXBP1; Syntaxin binding protein 1; Syntaxin-binding protein 1; Unc 18 homolog; Unc 18A; Unc-18A; Unc18 1; UNC18; Unc18-1
Target Background
This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.
Notification