Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 141-240 of human CD7 (P09564) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 141-240 of human CD7 (P09564) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14047A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD7 |
| Target Synonyms | GP40; TP41; Tp40; LEU-9; CD7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat cells | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 141-240 of human CD7 (P09564). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ | Uniprot ID | P09564 |
Uniprot Id
P09564
Target Species
Human
Target Name
CD7
Target Full Name
T-cell antigen CD7
Target Function
Not yet known.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Research Area
Immunology
Target Synonyms
CD7; CD7 antigen (p41); CD7 antigen; CD7 molecule; CD7_HUMAN; GP40; LEU 9; LEU9; p41 protein; T cell antigen CD7; T cell leukemia antigen ; T cell surface antigen Leu 9; T-cell antigen CD7; T-cell leukemia antigen; T-cell surface antigen Leu-9; Tp 40; Tp40; TP41
Target Background
This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
