-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 65-220 of human VPS24 (Q9Y3E7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VPS24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 65-220 of human VPS24 (Q9Y3E7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14113A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS24 |
| Target Synonyms | NEDF; VPS24; CGI-149 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A549, Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 65-220 of human VPS24 (Q9Y3E7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATL | Uniprot ID | Q9Y3E7 |
Uniprot Id
Q9Y3E7
Target Species
Human
Target Name
CHMP3
Target Full Name
Charged multivesicular body protein 3
Target Function
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Selectively binds to phosphatidylinositol 3,5-bisphosphate PtdIns(3,5)P2 and PtdIns(3,4)P2 in preference to other phosphoinositides tested. Involved in late stages of cytokinesis. Plays a role in endosomal sorting/trafficking of EGF receptor. Isoform 2 prevents stress-mediated cell death and accumulation of reactive oxygen species when expressed in yeast cells.
Target Subcellular Location
Cytoplasm, cytosol. Membrane; Lipid-anchor. Endosome. Late endosome membrane. Note=Localizes to the midbody of dividing cells.
Target Protein Families
SNF7 family
Target Tissue Specificity
Widely expressed. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
VPS 24; VPS24; CGI 149; CGI149 protein; Charged multivesicular body protein 3; CHMP3; CHMP3_HUMAN; Chromatin modifying protein 3; Chromatin-modifying protein 3; HGNC:29865; hVps24; NEDF; Neuroendocrine differentiation factor; Vacuolar protein sorting 24 (yeast); Vacuolar protein sorting 24 homolog (S. cerevisiae); Vacuolar protein sorting associated protein 24; Vacuolar protein sorting-associated protein 24; vps24
Target Background
This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene.
Notification