Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LSP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 240-339 of human LSP1 (P33241) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LSP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 240-339 of human LSP1 (P33241) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of various lysates, using LSP1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-14146A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LSP1 |
| Target Synonyms | WP34; pp52; LSP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 240-339 of human LSP1 (P33241). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP | Uniprot ID | P33241 |
Uniprot Id
P33241
Target Species
Human
Target Name
LSP1
Target Full Name
Lymphocyte-specific protein 1
Target Function
May play a role in mediating neutrophil activation and chemotaxis.
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Tissue Specificity
Activated T-lymphocytes.
Target Research Area
Immunology
Target Synonyms
47 kDa actin binding protein; 47 kDa actin-binding protein; 52 kDa phosphoprotein; F actin binding and cytoskeleton associated protein; Leufactin (leukocyte F-actin binding protein); Leufactin; Leukocyte F actin binding protein; Leukocyte specific protein 1; LSP 1; Lsp1; LSP1_HUMAN; Lymphocyte specific antigen WP34; Lymphocyte specific protein 1; Lymphocyte specific protein pp52; Lymphocyte-specific antigen WP34; Lymphocyte-specific protein 1; OTTHUMP00000014138; OTTHUMP00000014139; OTTHUMP00000014140; OTTHUMP00000069612; OTTHUMP00000069614; OTTHUMP00000069615; OTTHUMP00000069616; pp52; Protein pp52; S37 protein; WP 34; WP34
Target Background
This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
