-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEKK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK3 (Q99759) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEKK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK3 (Q99759) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14152A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEKK3 |
| Target Synonyms | MEKK3; MAPKKK3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Jurkat, Mouse spleen, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK3 (Q99759). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDL | Uniprot ID | Q99759 |
Uniprot Id
Q99759
Target Species
Human
Target Name
MAP3K3
Target Full Name
Mitogen-activated protein kinase kinase kinase 3
Target Function
Component of a protein kinase signal transduction cascade. Mediates activation of the NF-kappa-B, AP1 and DDIT3 transcriptional regulators.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily
Target Synonyms
M3K3_HUMAN; MAP/ERK kinase kinase 3; MAP3K3; MAPK/ERK kinase kinase 3; MAPKKK3; MEK kinase 3; MEKK 3; MEKK3; Mitogen activated protein kinase kinase kinase 3; Mitogen-activated protein kinase kinase kinase 3
Target Background
This gene product is a 626-amino acid polypeptide that is 96.5% identical to mouse Mekk3. Its catalytic domain is closely related to those of several other kinases, including mouse Mekk2, tobacco NPK, and yeast Ste11. Northern blot analysis revealed a 4.6-kb transcript that appears to be ubiquitously expressed. This protein directly regulates the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by activating SEK and MEK1/2 respectively; it does not regulate the p38 pathway. In cotransfection assays, it enhanced transcription from a nuclear factor kappa-B (NFKB)-dependent reporter gene, consistent with a role in the SAPK pathway. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Notification