-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 689-788 of human MARK2 (Q7KZI7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MARK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 689-788 of human MARK2 (Q7KZI7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14168A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MARK2 |
| Target Synonyms | EMK1; EMK-1; PAR-1; Par1b; Par-1b; MARK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BT-474, Mouse brain, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 689-788 of human MARK2 (Q7KZI7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL | Uniprot ID | Q7KZI7 |
Uniprot Id
Q7KZI7
Target Species
Human
Target Name
MARK2
Target Full Name
Serine/threonine-protein kinase MARK2
Target Function
Serine/threonine-protein kinase. Involved in cell polarity and microtubule dynamics regulation. Phosphorylates CRTC2/TORC2, DCX, HDAC7, KIF13B, MAP2, MAP4 and RAB11FIP2. Phosphorylates the microtubule-associated protein MAPT/TAU. Plays a key role in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. Regulates epithelial cell polarity by phosphorylating RAB11FIP2. Involved in the regulation of neuronal migration through its dual activities in regulating cellular polarity and microtubule dynamics, possibly by phosphorylating and regulating DCX. Regulates axogenesis by phosphorylating KIF13B, promoting interaction between KIF13B and 14-3-3 and inhibiting microtubule-dependent accumulation of KIF13B. Also required for neurite outgrowth and establishment of neuronal polarity. Regulates localization and activity of some histone deacetylases by mediating phosphorylation of HDAC7, promoting subsequent interaction between HDAC7 and 14-3-3 and export from the nucleus. Also acts as a positive regulator of the Wnt signaling pathway, probably by mediating phosphorylation of dishevelled proteins (DVL1, DVL2 and/or DVL3). Modulates the developmental decision to build a columnar versus a hepatic epithelial cell apparently by promoting a switch from a direct to a transcytotic mode of apical protein delivery. Essential for the asymmetric development of membrane domains of polarized epithelial cells.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cytoplasm. Lateral cell membrane. Cytoplasm, cytoskeleton. Cell projection, dendrite. Cytoplasm. Note=Phosphorylation at Thr-596 by PRKCZ/aPKC and subsequent interaction with 14-3-3 protein YWHAZ promotes relocation from the cell membrane to the cytoplasm.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
Target Tissue Specificity
High levels of expression in heart, brain, skeletal muscle and pancreas, lower levels observed in lung, liver and kidney.
Target Synonyms
ELKL motif kinase 1; ELKL motif kinase; EMK-1; EMK1; MAP/microtubule affinity regulating kinase 2; MAP/microtubule affinity-regulating kinase 2; Mark2; MARK2_HUMAN; MGC99619; PAR 1; Par 1b; PAR1 homolog; Par1b; Ser/Thr protein kinase PAR 1B; Serine/threonine protein kinase EMK; Serine/threonine protein kinase MARK2; Serine/threonine-protein kinase MARK2
Target Background
This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification