-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENTPD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human ENTPD5 (O75356) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ENTPD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human ENTPD5 (O75356) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14224A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENTPD5 |
| Target Synonyms | PCPH; CD39L4; NTPDase-5; ENTPD5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human ENTPD5 (O75356). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ | Uniprot ID | O75356 |
Uniprot Id
O75356
Target Species
Human
Target Name
ENTPD5
Target Full Name
Nucleoside diphosphate phosphatase ENTPD5
Target Function
Uridine diphosphatase (UDPase) that promotes protein N-glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. The nucleotide hydrolyzing preference is GDP > IDP > UDP, but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling.
Target Subcellular Location
Endoplasmic reticulum. Secreted.
Target Protein Families
GDA1/CD39 NTPase family
Target Tissue Specificity
Expressed in adult liver, kidney, prostate, testis and colon. Much weaker expression in other tissues.
Target Synonyms
ENTPD5; CD39L4; PCPH; Ectonucleoside triphosphate diphosphohydrolase 5; NTPDase 5; CD39 antigen-like 4; ER-UDPase; Guanosine-diphosphatase ENTPD5; GDPase ENTPD5; Nucleoside diphosphatase; Uridine-diphosphatase ENTPD5; UDPase ENTPD5
Target Background
The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases.
Notification