-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Renalase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Renalase (Q5VYX0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Renalase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Renalase (Q5VYX0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14271A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Renalase |
| Target Synonyms | C10orf59; RENALASE; RNLS; Renalase | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse testis, Rat kidney, Rat liver, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Renalase (Q5VYX0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKE | Uniprot ID | Q5VYX0 |
Uniprot Id
Q5VYX0
Target Species
Human
Target Name
RNLS
Target Full Name
Renalase
Target Function
Catalyzes the oxidation of the less abundant 1,2-dihydro-beta-NAD(P) and 1,6-dihydro-beta-NAD(P) to form beta-NAD(P)(+). The enzyme hormone is secreted by the kidney, and circulates in blood and modulates cardiac function and systemic blood pressure. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.
Target Subcellular Location
Secreted.
Target Protein Families
Renalase family
Target Tissue Specificity
Secreted into the blood by the kidney. Highly expressed in the kidney, expressed at lower level in heart, skeletal muscle and small intestine. Its plasma concentration is markedly reduced in patients with end-stage renal disease, as compared with healthy
Target Synonyms
6530404N21Rik; AI452315; AW060440; C10orf59; Chromosome 10 open reading frame 59; FLJ11218; HGNC:25641; Hypothetical protein LOC55328; MAO C; MAO-C; mMAO C; Monoamine oxidase C; Monoamine oxidase-C; Renalase; Renalase FAD dependent amine oxidase ; RNLS; RNLS_HUMAN
Target Background
Enables several functions, including NADH binding activity; epinephrine binding activity; and monoamine oxidase activity. Involved in negative regulation of blood pressure and negative regulation of heart rate. Located in extracellular region. Implicated in essential hypertension and hypertension. Biomarker of end stage renal disease.
Notification