-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CEACAM6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CEACAM6 (P40199) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CEACAM6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CEACAM6 (P40199) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14320A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CEACAM6 |
| Target Synonyms | NCA; CEAL; CD66c; CEACAM6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CEACAM6 (P40199). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ | Uniprot ID | P40199 |
Uniprot Id
P40199
Target Species
Human
Target Name
CEACAM6
Target Full Name
Cell adhesion molecule CEACAM6
Target Function
Cell surface glycoprotein that plays a role in cell adhesion and tumor progression. Intercellular adhesion occurs in a calcium- and fibronectin-independent manner. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM5 and CEACAM8. Heterophilic interaction with CEACAM8 occurs in activated neutrophils. Plays a role in neutrophil adhesion to cytokine-activated endothelial cells. Plays a role as an oncogene by promoting tumor progression; positively regulates cell migration, cell adhesion to endothelial cells and cell invasion. Also involved in the metastatic cascade process by inducing gain resistance to anoikis of pancreatic adenocarcinoma and colorectal carcinoma cells.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Apical cell membrane. Cell surface.
Target Protein Families
Immunoglobulin superfamily, CEA family
Target Tissue Specificity
Expressed in neutrophils. Expressed in columnar epithelial and goblet cells of the colon. Expressed in numerous tumor cell lines (at protein level).
Target Research Area
Tags & Cell Markers
Target Synonyms
Carcinoembryonic antigen related cell adhesion molecule 6 ; Carcinoembryonic antigen related cell adhesion molecule 6 (non specific cross reacting antigen); Carcinoembryonic antigen-related cell adhesion molecule 6; CD 66c; CD66c; CD66c antigen; CEA LIKE PROTEIN; CEACAM 6; CEACAM6; CEAL; CEAM6_HUMAN; MGC93832; NCA; Non specific cross reacting antigen; Non-specific crossreacting antigen; Normal cross reacting antigen; Normal cross-reacting antigen
Target Background
This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tumor markers in serum immunoassay determinations of carcinoma. This gene affects the sensitivity of tumor cells to adenovirus infection. The protein encoded by this gene acts as a receptor for adherent-invasive E. coli adhesion to the surface of ileal epithelial cells in patients with Crohn's disease. This gene is clustered with genes and pseudogenes of the cell adhesion molecules subgroup of the CEA family on chromosome 19.
Notification