-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 842-941 of human ERAP1 (Q9NZ08) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ERAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 842-941 of human ERAP1 (Q9NZ08) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14335A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERAP1 |
| Target Synonyms | ALAP; A-LAP; ARTS1; ERAAP; APPILS; ARTS-1; ERAAP1; PILSAP; PILS-AP; ERAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat, Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 842-941 of human ERAP1 (Q9NZ08). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM | Uniprot ID | Q9NZ08 |
Uniprot Id
Q9NZ08
Target Species
Human
Target Name
ERAP1
Target Full Name
Endoplasmic reticulum aminopeptidase 1
Target Function
Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase M1 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
A LAP; A-LAP; Adipocyte derived leucine aminopeptidase; Adipocyte-derived leucine aminopeptidase; ALAP; Aminopeptidase PILS; Aminopeptidase regulator of TNFR1 shedding; APPILS; ARTS 1; ARTS-1; Arts1; Endoplasmic reticulum aminopeptidase 1; Endoplasmic reticulum aminopeptidase associated with antigen processing; ERAAP; ERAAP1; ERAP 1; Erap1; ERAP1_HUMAN; KIAA0525; kiaa0525 protein; PILS AP; PILS-AP; PILSA; PILSAP; Puromycin insensitive leucyl specific aminopeptidase; Puromycin-insensitive leucyl-specific aminopeptidase; Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator; type 1 tumor necrosis factor receptors shedding aminopeptidase regulator; VEGF-induced aminopeptidase
Target Background
The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.
Notification