-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 3562-3661 of human SMG1 (Q96Q15) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SMG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 3562-3661 of human SMG1 (Q96Q15) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14367A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMG1 |
| Target Synonyms | ATX; LIP; 61E3.4; SMG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, C2C12 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 3562-3661 of human SMG1 (Q96Q15). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV | Uniprot ID | Q96Q15 |
Uniprot Id
Q96Q15
Target Species
Human
Target Name
SMG1
Target Full Name
Serine/threonine-protein kinase SMG1
Target Function
Serine/threonine protein kinase involved in both mRNA surveillance and genotoxic stress response pathways. Recognizes the substrate consensus sequence [ST]-Q. Plays a central role in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by phosphorylating UPF1/RENT1. Recruited by release factors to stalled ribosomes together with SMG8 and SMG9 (forming the SMG1C protein kinase complex), and UPF1 to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Also acts as a genotoxic stress-activated protein kinase that displays some functional overlap with ATM. Can phosphorylate p53/TP53 and is required for optimal p53/TP53 activation after cellular exposure to genotoxic stress. Its depletion leads to spontaneous DNA damage and increased sensitivity to ionizing radiation (IR). May activate PRKCI but not PRKCZ
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
PI3/PI4-kinase family
Target Tissue Specificity
Widely expressed, with highest level in heart and skeletal muscle. Expressed in placenta, brain, lung and spleen, but not in liver.
Target Synonyms
61E3.4; ATX; hSMG-1; hSMG1; KIAA0421; Lambda interacting protein; Lambda-interacting protein; Lambda/iota protein kinase C interacting protein; Lambda/iota protein kinase C-interacting protein; LIP; Phosphatidylinositol 3 kinase related kinase; Phosphatidylinositol 3 kinase related protein kinase; PI 3 kinase related kinase SMG 1; Serine/threonine protein kinase SMG1; Serine/threonine-protein kinase SMG1; SMG-1; smg1; SMG1_HUMAN
Target Background
This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternatively spliced transcript variants have been described, but their full-length nature has yet to be determined.
Notification