-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HLA-DMB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-DMB (P28068) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HLA-DMB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-DMB (P28068) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14414A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HLA-DMB |
| Target Synonyms | RING7; D6S221E; HLA-DMB | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-DMB (P28068). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATH | Uniprot ID | P28068 |
Uniprot Id
P28068
Target Species
Human
Target Name
HLA-DMB
Target Full Name
HLA class II histocompatibility antigen, DM beta chain
Target Function
Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
Target Subcellular Location
Late endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note=Localizes to late endocytic compartment. Associates with lysosome membranes.
Target Protein Families
MHC class II family
Target Research Area
Immunology
Target Synonyms
HLA-DMB; DMB; RING7HLA class II histocompatibility antigen; DM beta chain; MHC class II antigen DMB; Really interesting new gene 7 protein
Target Background
HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.
Notification