-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLTP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PLTP (P55058) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PLTP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PLTP (P55058) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14416A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLTP |
| Target Synonyms | BPIFE; HDLCQ9; PLTP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PLTP (P55058). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD | Uniprot ID | P55058 |
Uniprot Id
P55058
Target Species
Human
Target Name
PLTP
Target Full Name
Phospholipid transfer protein
Target Function
Mediates the transfer of phospholipids and free cholesterol from triglyceride-rich lipoproteins (low density lipoproteins or LDL and very low density lipoproteins or VLDL) into high-density lipoproteins (HDL) as well as the exchange of phospholipids between triglyceride-rich lipoproteins themselves. Facilitates the transfer of a spectrum of different lipid molecules, including diacylglycerol, phosphatidic acid, sphingomyelin, phosphatidylcholine, phosphatidylinositol, phosphatidylglycerol, cerebroside and phosphatidyl ethanolamine. Plays an important role in HDL remodeling which involves modulating the size and composition of HDL. Also plays a key role in the uptake of cholesterol from peripheral cells and tissues that is subsequently transported to the liver for degradation and excretion. Two distinct forms of PLTP exist in plasma: an active form that can transfer phosphatidylcholine from phospholipid vesicles to HDL, and an inactive form that lacks this capability.
Target Subcellular Location
Secreted. Nucleus.
Target Protein Families
BPI/LBP/Plunc superfamily, BPI/LBP family
Target Tissue Specificity
Widely expressed. Highest level of expression in the ovary, thymus and placenta, with moderate levels found in the pancreas, small intestine, testis, lung and prostrate. Low level expression in the kidney, liver and spleen, with very low levels found in t
Target Research Area
Transport
Target Synonyms
BPI fold containing family E; BPIFE; HDLCQ9; High density lipoprotein cholesterol level quantitative trait locus 9; included; Lipid transfer protein II; OD107; Phospholipid transfer protein; Plasma phospholipid transfer protein ; Pltp; PLTP_HUMAN
Target Background
The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene.
Notification