Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 384-483 of human PGD (P52209) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against PGD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 384-483 of human PGD (P52209) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-14451A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGD |
| Target Synonyms | 6PGD; PGD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Jurkat, Mouse liver, Mouse lung, Mouse spleen, Rat kidney, Rat liver, Rat lung | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 384-483 of human PGD (P52209). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA | Uniprot ID | P52209 |
Uniprot Id
P52209
Target Species
Human
Target Name
PGD
Target Full Name
6-phosphogluconate dehydrogenase, decarboxylating
Target Function
Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH.
Target Subcellular Location
Cytoplasm.
Target Protein Families
6-phosphogluconate dehydrogenase family
Target Research Area
Metabolism
Target Synonyms
0610042A05Rik; 6 phosphogluconate dehydrogenase; decarboxylating; 6-phosphogluconate dehydrogenase; 6PGD; 6PGD_HUMAN; AU019875; C78335; decarboxylating; OTTMUSP00000011754; Pgd; Phosphogluconate dehydrogenase; RP23-249G3.4
Target Background
6-phosphogluconate dehydrogenase is the second dehydrogenase in the pentose phosphate shunt. Deficiency of this enzyme is generally asymptomatic, and the inheritance of this disorder is autosomal dominant. Hemolysis results from combined deficiency of 6-phosphogluconate dehydrogenase and 6-phosphogluconolactonase suggesting a synergism of the two enzymopathies. Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
