-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRTC3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 520-619 of human CRTC3 (Q6UUV7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CRTC3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 520-619 of human CRTC3 (Q6UUV7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14512A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRTC3 |
| Target Synonyms | TORC3; TORC-3; CRTC3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, MCF7, Mouse brain, PC-12 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 520-619 of human CRTC3 (Q6UUV7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL | Uniprot ID | Q6UUV7 |
Uniprot Id
Q6UUV7
Target Species
Human
Target Name
CRTC3
Target Full Name
CREB-regulated transcription coactivator 3
Target Function
Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
TORC family
Target Tissue Specificity
Predominantly expressed in B and T lymphocytes. Highest levels in lung. Also expressed in brain, colon, heart, kidney, ovary, and prostate. Weak expression in liver, pancreas, muscle, small intestine, spleen and stomach.
Target Synonyms
CREB regulated transcription coactivator 3; CREB-regulated transcription coactivator 3; CRTC 3; CRTC3; CRTC3_HUMAN; FLJ21868; TORC 3; TORC-3; TORC3; Transducer of CREB protein 3; Transducer of regulated cAMP response element binding protein (CREB) 3; Transducer of regulated cAMP response element binding protein 3; Transducer of regulated cAMP response element-binding protein 3; Transducer of regulated CREB protein 3
Target Background
This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocation event between this gene and Notch coactivator mastermind-like gene 2, which results in a fusion protein, has been reported in mucoepidermoid carcinomas. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Notification