-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NTH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human NTH1 (NP_002519.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NTH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human NTH1 (NP_002519.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14560A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NTH1 |
| Target Synonyms | FAP3; NTH1; OCTS3; hNTH1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human NTH1 (NP_002519.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSL | Uniprot ID | P78549 |
Uniprot Id
P78549
Target Species
Human
Target Name
NTHL1
Target Full Name
Endonuclease III-like protein 1
Target Function
Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines. Has also 8-oxo-7,8-dihydroguanine (8-oxoG) DNA glycosylase activity. Acts preferentially on DNA damage opposite guanine residues in DNA. Is able to process lesions in nucleosomes without requiring or inducing nucleosome disruption.
Target Involvement
Familial adenomatous polyposis 3 (FAP3)
Target Subcellular Location
Nucleus. Mitochondrion.
Target Protein Families
Nth/MutY family
Target Tissue Specificity
Widely expressed with highest levels in heart and lowest levels in lung and liver.
Target Synonyms
Bifunctional DNA N glycoslyase/DNA (apurinic or apyrimidinic site) lyase; DNA glycoslyase/AP lyase; Endonuclease III like protein 1; Endonuclease III-like protein 1; hNTH1; NTH 1; nth endonuclease III like 1 (E. coli); NTH endonuclease III Like 1; NTH1; NTHL 1; Nthl1; NTHL1_HUMAN; OCTS 3; OCTS3
Target Background
The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity.
Notification