-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR109A/HM74A/HCAR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GPR109A/HM74A/HCAR2 (NP_808219.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR109A/HM74A/HCAR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GPR109A/HM74A/HCAR2 (NP_808219.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14700A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR109A/HM74A/HCAR2 |
| Target Synonyms | HCA2; HM74a; HM74b; PUMAG; NIACR1; Puma-g; GPR109A; GPR109A/HM74A/HCAR2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GPR109A/HM74A/HCAR2 (NP_808219.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CRLMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNRTAAIISCLLWGITIGLTVHLLKKKMPIQNGGANLCSSFSICHTFQWHEAMFLLEFFLP | Uniprot ID | Q8TDS4 |
Uniprot Id
Q8TDS4
Target Species
Human
Target Name
HCAR2
Target Full Name
Hydroxycarboxylic acid receptor 2
Target Function
Acts as a high affinity receptor for both nicotinic acid (also known as niacin) and (D)-beta-hydroxybutyrate and mediates increased adiponectin secretion and decreased lipolysis through G(i)-protein-mediated inhibition of adenylyl cyclase. This pharmacological effect requires nicotinic acid doses that are much higher than those provided by a normal diet. Mediates nicotinic acid-induced apoptosis in mature neutrophils. Receptor activation by nicotinic acid results in reduced cAMP levels which may affect activity of cAMP-dependent protein kinase A and phosphorylation of target proteins, leading to neutrophil apoptosis. The rank order of potency for the displacement of nicotinic acid binding is 5-methyl pyrazole-3-carboxylic acid = pyridine-3-acetic acid > acifran > 5-methyl nicotinic acid = acipimox >> nicotinuric acid = nicotinamide.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expression largely restricted to adipose tissue and spleen. Expressed on mature neutrophils but not on immature neutrophils or eosinophils.
Target Research Area
Cardiovascular
Target Synonyms
HCAR2; GPR109A; HCA2; HM74A; NIACR1; Hydroxycarboxylic acid receptor 2; G-protein coupled receptor 109A; G-protein coupled receptor HM74A; Niacin receptor 1; Nicotinic acid receptor
Target Background
Predicted to enable nicotinic acid receptor activity. Involved in neutrophil apoptotic process and positive regulation of neutrophil apoptotic process. Located in cell junction and plasma membrane.
Notification