-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Sin3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sin3A (NP_056292.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Sin3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sin3A (NP_056292.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14702A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIN3A |
| Target Synonyms | WITKOS; DEL15Q24; CHR15DELq24; Sin3A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293F, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sin3A (NP_056292.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQ | Uniprot ID | Q96ST3 |
Uniprot Id
Q96ST3
Target Species
Human
Target Name
SIN3A
Target Full Name
Paired amphipathic helix protein Sin3a
Target Function
Acts as a transcriptional repressor. Corepressor for REST. Interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities. Also interacts with MXD1-MAX heterodimers to repress transcription by tethering SIN3A to DNA. Acts cooperatively with OGT to repress transcription in parallel with histone deacetylation. Involved in the control of the circadian rhythms. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex through histone deacetylation. Cooperates with FOXK1 to regulate cell cycle progression probably by repressing cell cycle inhibitor genes expression. Required for cortical neuron differentiation and callosal axon elongation.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Note=Recruited to the nucleolus by SAP30L.
Target Tissue Specificity
Expressed in the developing brain, with highest levels of expression detected in the ventricular zone of various cortical regions.
Target Synonyms
AW553200; DKFZP434K2235; FLJ90319; Histone deacetylase complex subunit Sin 3a; Histone deacetylase complex subunit Sin3a; KIAA0700; Kiaa4126; mKIAA4126; Paired amphipathic helix protein Sin 3a; Paired amphipathic helix protein Sin3a; Sin 3a; SIN3 homolog A; SIN3 homolog A transcription regulator (yeast); SIN3 homolog A transcription regulator; SIN3 transcription regulator homolog A; Sin3a; SIN3A protein; SIN3A_HUMAN; Transcriptional co repressor Sin 3A; Transcriptional co repressor Sin3A; Transcriptional corepressor Sin3a; Transcriptional regulator SIN3A
Target Background
The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.
Notification