Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HAO1/GOX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HAO1/GOX (NP_060015.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HAO1/GOX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HAO1/GOX (NP_060015.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14727A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HAO1/GOX |
| Target Synonyms | GO; GOX; GOX1; HAOX1; HAO1/GOX | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HAO1/GOX (NP_060015.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQS | Uniprot ID | Q9UJM8 |
Uniprot Id
Q9UJM8
Target Species
Human
Target Name
HAO1
Target Full Name
2-Hydroxyacid oxidase 1
Target Function
Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate.
Target Subcellular Location
Peroxisome.
Target Protein Families
FMN-dependent alpha-hydroxy acid dehydrogenase family
Target Tissue Specificity
Liver.
Target Synonyms
(S) 2 hydroxy acid oxidase ; Glycolate oxidase; GOX; GOX1; HAO1; HAOX1; HAOX1_HUMAN; Hydroxyacid oxidase 1; MGC142225; MGC142227; OTTHUMP00000030231
Target Background
This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
