-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDHA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 248-348 of human PDHA1 (NP_000275.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDHA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 248-348 of human PDHA1 (NP_000275.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14767A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDHA1 |
| Target Synonyms | PDHA; PDHAD; PHE1A; E1alpha; PDHCE1A; PDHA1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 248-348 of human PDHA1 (NP_000275.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIED | Uniprot ID | P08559 |
Uniprot Id
P08559
Target Species
Human
Target Name
PDHA1
Target Full Name
Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
Target Function
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.
Target Involvement
Pyruvate dehydrogenase E1-alpha deficiency (PDHAD)
Target Subcellular Location
Mitochondrion matrix.
Target Tissue Specificity
Ubiquitous.
Target Research Area
Metabolism
Target Synonyms
ODPA_HUMAN; PDH; PDHA; PDHA1; PDHCE1A; PDHE1 A type I ; PDHE1-A type I; PHE1A; Pyruvate Dehydrogenase (lipoamide) alpha 1; Pyruvate dehydrogenase complex, E1 alpha polypeptide 1; Pyruvate Dehydrogenase E1 alpha; Pyruvate dehydrogenase E1 component subunit alpha; Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
Target Background
The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle. The PDH complex is composed of multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). The E1 enzyme is a heterotetramer of two alpha and two beta subunits. This gene encodes the E1 alpha 1 subunit containing the E1 active site, and plays a key role in the function of the PDH complex. Mutations in this gene are associated with pyruvate dehydrogenase E1-alpha deficiency and X-linked Leigh syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification