-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Galectin 3/LGALS3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Galectin 3/LGALS3 (P17931) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Galectin 3/LGALS3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Galectin 3/LGALS3 (P17931) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14902A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Galectin 3/LGALS3 |
| Target Synonyms | L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2; Galectin 3/LGALS3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-118 MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Galectin 3/LGALS3 (P17931). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKI | Uniprot ID | P17931 |
Uniprot Id
P17931
Target Species
Human
Target Name
LGALS3
Target Full Name
Galectin-3
Target Function
Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes.
Target Subcellular Location
Cytoplasm. Nucleus. Secreted.
Target Tissue Specificity
A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes.
Target Synonyms
L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2; Galectin 3/LGALS3
Target Background
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
Notification