-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Vinculin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Vinculin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14925A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Vinculin |
| Target Synonyms | MV; MVCL; CMD1W; CMH15; HEL114; Vinculin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, Mouse brain, PC-12, Rat lung, RD | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM | Uniprot ID | P18206 |
Uniprot Id
P18206
Target Species
Human
Target Name
VCL
Target Full Name
Vinculin
Target Function
Actin filament (F-actin)-binding protein involved in cell-matrix adhesion and cell-cell adhesion. Regulates cell-surface E-cadherin expression and potentiates mechanosensing by the E-cadherin complex. May also play important roles in cell morphology and locomotion.
Target Involvement
Cardiomyopathy, dilated 1W (CMD1W); Cardiomyopathy, familial hypertrophic 15 (CMH15)
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction, adherens junction. Cell junction, focal adhesion. Cytoplasm, cytoskeleton. Cell membrane, sarcolemma; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Vinculin/alpha-catenin family
Target Tissue Specificity
Metavinculin is muscle-specific.
Target Research Area
Cell Adhesion
Target Synonyms
CMD1W; CMH15; Epididymis luminal protein 114; HEL114; Metavinculin; MV; MVCL; OTTHUMP00000019861; OTTHUMP00000019862; VCL; VINC; VINC_HUMAN; Vinculin
Target Background
Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
Notification