-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human PSMC4 (NP_006494.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PSMC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human PSMC4 (NP_006494.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15045A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMC4 |
| Target Synonyms | S6; RPT3; TBP7; TBP-7; MIP224; PSMC4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293F, Mouse brain, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human PSMC4 (NP_006494.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYA | Uniprot ID | P43686 |
Uniprot Id
P43686
Target Species
Human
Target Name
PSMC4
Target Full Name
26S proteasome regulatory subunit 6B
Target Function
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. PSMC4 belongs to the heterohexameric ring of AAA (ATPases associated with diverse cellular activities) proteins that unfolds ubiquitinated target proteins that are concurrently translocated into a proteolytic chamber and degraded into peptides.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
AAA ATPase family
Target Synonyms
26S protease regulatory subunit 6B; 26S proteasome AAA ATPase subunit RPT3; 26S proteasome AAA-ATPase subunit RPT3; MB67 interacting protein; MB67-interacting protein; MIP224; Protease 26S subunit 6 ; Proteasome (prosome macropain) 26S subunit ATPase 4; Proteasome 19S S6; Proteasome 26S subunit ATPase 4; Proteasome 26S subunit; ATPase; 4; PRS6B_HUMAN; PSMC4; RPT3; S6; Tat binding protein 7; TAT-binding protein 7; TBP 7; TBP-7
Target Background
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification