-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD152/CTLA-4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-162 of human CD152/CTLA-4 (NP_005205.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD152/CTLA-4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-162 of human CD152/CTLA-4 (NP_005205.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15068A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD152/CTLA-4 |
| Target Synonyms | CD; GSE; GRD4; ALPS5; CD152; CTLA-4; IDDM12; CELIAC3; CD152/CTLA-4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F transfected with CD152/CTLA-4, Recombinant Human CTLA-4 Protein | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 37-162 of human CD152/CTLA-4 (NP_005205.2) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF | Uniprot ID | P16410 |
Uniprot Id
P16410
Target Species
Human
Target Name
CTLA4
Target Full Name
Cytotoxic T-lymphocyte protein 4
Target Function
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Target Involvement
Systemic lupus erythematosus (SLE); Diabetes mellitus, insulin-dependent, 12 (IDDM12); Celiac disease 3 (CELIAC3); Autoimmune lymphoproliferative syndrome 5 (ALPS5)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Note=Exists primarily an intracellular antigen whose surface expression is tightly regulated by restricted trafficking to the cell surface and rapid internalization.
Target Tissue Specificity
Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation.
Target Research Area
Immunology, Cancer
Target Synonyms
CTLA4; CD152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
Target Background
This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases.
Notification