-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Synapsin-1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 401-500 of human Synapsin-1 (NP_008881.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against Synapsin-1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 401-500 of human Synapsin-1 (NP_008881.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15663A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Synapsin-1 |
| Target Synonyms | SYNI; EPILX; MRX50; SYN1a; SYN1b; EPILX1; Synapsin-1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 401-500 of human Synapsin-1 (NP_008881.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPA | Uniprot ID | P17600 |
Uniprot Id
P17600
Target Species
Human
Target Name
SYN1
Target Full Name
Synapsin-1
Target Function
Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level.
Target Involvement
Epilepsy X-linked, with variable learning disabilities and behavior disorders (XELBD)
Target Subcellular Location
Cell junction, synapse. Golgi apparatus.
Target Protein Families
Synapsin family
Target Research Area
Neuroscience
Target Synonyms
Brain protein 4.1; SYN 1; SYN 1a; SYN 1b; SYN I; SYN1; SYN1_HUMAN; SYN1a; SYN1b; Synapsin 1; Synapsin I; Synapsin-1; Synapsin1; SynapsinI; SYNI
Target Background
This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification