-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Histone H2B (testis specific)? was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2B (testis specific) (NP_733759.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
The antibody against Histone H2B (testis specific)? was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2B (testis specific) (NP_733759.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
| Cat.No | ADA-15679A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Histone H2B (testis specific) |
| Target Synonyms | STBP; TH2B; H2BFU; TSH2B; hTSH2B; TSH2B.1; HIST1H2BA; bA317E16.3; Histone H2B (testis specific) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F transfected with Histone H2B (testis specific) (Human), Mouse testis, Rat testis | Application | ELISA, WB, ChIP, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2B (testis specific) (NP_733759.1). | Immunogen Sequence | MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAV |
|---|---|---|---|
| Uniprot ID | Q96A08 |
Uniprot Id
Q96A08
Target Species
Human
Target Name
H2BC1
Target Full Name
Histone H2B type 1-A
Target Function
Variant histone specifically required to direct the transformation of dissociating nucleosomes to protamine in male germ cells. Entirely replaces classical histone H2B prior nucleosome to protamine transition and probably acts as a nucleosome dissociating factor that creates a more dynamic chromatin, facilitating the large-scale exchange of histones. Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Also found in fat cells, its function and the presence of post-translational modifications specific to such cells are still unclear.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Histone H2B family
Target Tissue Specificity
Mainly expressed in testis, and the corresponding protein is also present in mature sperm (at protein level). Also found in some fat cells.
Target Synonyms
HIST1H2BA; testis; bA317E16.3; H2B; H2B histone family member U; H2B histone family member U testis specific; H2B histone family; member U; (testis specific); H2B testis; H2B1A_HUMAN; H2BFU; H2BT; HIST1H2BA; Histone 1; H2ba; Histone cluster 1 H2ba; Histone H2B; Histone H2B testis; Histone H2B type 1 A; Histone H2B type 1-A; Histone H2B type 1A; STBP; Testis specific histone H2B; Testis-specific histone H2B; TSH 2B; TSH2B; TSH2B.1
Target Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element.
Notification