Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AT1R/AGTR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AT1R/AGTR1 (P30556) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AT1R/AGTR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AT1R/AGTR1 (P30556) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15859A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AT1R/AGTR1 |
| Target Synonyms | AT1; AG2S; AT1B; AT1R; ATR1; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1B; AT1R/AGTR1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AT1R/AGTR1 (P30556). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYL | Uniprot ID | P30556 |
Uniprot Id
P30556
Target Species
Human
Target Name
AGTR1
Target Full Name
Type-1 angiotensin II receptor
Target Function
Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, it is able to recognize and internalize the complex formed by secreted ACE2 and SARS-CoV-2 spike protein through DNM2/dynamin 2-dependent endocytosis.
Target Involvement
Renal tubular dysgenesis (RTD)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Liver, lung, adrenal and adrenocortical adenomas.
Target Research Area
Cancer
Target Synonyms
AG2S; Agtr 1; Agtr1; AGTR1_HUMAN; Agtr1a; AGTR1B; Ang II; Angiotensin II receptor type 1; Angiotensin II type-1 receptor; Angiotensin receptor 1; Angiotensin receptor 1B; AT 1B; AT 1r; AT1; At1a; AT1AR; AT1B; AT1BR; AT1R; AT2R1; AT2R1A; AT2R1B; HAT1R; Type 1 angiotensin II receptor; Type 1B angiotensin II receptor; Type-1 angiotensin II receptor
Target Background
Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. Alternative splicing of this gene results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
