-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-70 of human NDUFA1 (O15239) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NDUFA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-70 of human NDUFA1 (O15239) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15909A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFA1 |
| Target Synonyms | MWFE; ZNF183; CI-MWFE; MC1DN12; NDUFA1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, U-2 OS | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-70 of human NDUFA1 (O15239). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID | Uniprot ID | O15239 |
Uniprot Id
O15239
Target Species
Human
Target Name
NDUFA1
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Involvement
Mitochondrial complex I deficiency (MT-C1D)
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.
Target Protein Families
Complex I NDUFA1 subunit family
Target Tissue Specificity
Primarily expressed in heart and skeletal muscle.
Target Synonyms
NDUFA1; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; Complex I-MWFE; CI-MWFE; NADH-ubiquinone oxidoreductase MWFE subunit
Target Background
The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function.
Notification