Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP39 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 466-565 of Human USP39 (Q53GS9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against USP39 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 466-565 of Human USP39 (Q53GS9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15916A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP39 |
| Target Synonyms | 65K; SAD1; CGI-21; HSPC332; SNRNP65; USP39 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 466-565 of Human USP39 (Q53GS9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA | Uniprot ID | Q53GS9? |
Uniprot Id
Q53GS9
Target Species
Human
Target Name
USP39
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 39
Target Synonyms
65K; CGI 21; CGI-21; FLJ33136; HSPC332; Inactive ubiquitin specific peptidase 39; Inactive ubiquitin-specific peptidase 39; MGC75069; PRO2855; S. CEREVISIAE, HOMOLOG OF SAD1; SAD1; SAD1 homolog; Small nuclear ribonucleoprotein 65kDa (U4/U6.U5); snRNP ASSEMBLY DEFECTIVE 1; SnRNP assembly defective 1 homolog; SNRNP65; SNUT2_HUMAN; U4/U6.U5 tri snRNP associated 65 kDa protein; U4/U6.U5 tri snRNP associated protein 2; U4/U6.U5 tri-snRNP-associated 65 kDa protein; U4/U6.U5 tri-snRNP-associated protein 2; Ubiquitin specific peptidase 39; Ubiquitin specific protease 39; USP39
Target Background
Predicted to enable thiol-dependent deubiquitinase and zinc ion binding activity. Involved in spliceosomal complex assembly. Located in nucleoplasm. Part of U4/U6 x U5 tri-snRNP complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
