-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HRAS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 90-189 of human HRAS (P01112) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HRAS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 90-189 of human HRAS (P01112) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15960A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HRAS |
| Target Synonyms | CTLO; HAMSV; HRAS1; RASH1; p21ras; C-H-RAS; H-RASIDX; C-BAS/HAS; C-HA-RAS1; HRAS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 90-189 of human HRAS (P01112). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS | Uniprot ID | P01112 |
Uniprot Id
P01112
Target Species
Human
Target Name
HRAS
Target Full Name
GTPase HRas
Target Function
Involved in the activation of Ras protein signal transduction. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Target Involvement
Costello syndrome (CSTLO); Congenital myopathy with excess of muscle spindles (CMEMS); Thyroid cancer, non-medullary, 2 (NMTC2); Bladder cancer (BLC); Schimmelpenning-Feuerstein-Mims syndrome (SFM)
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Golgi apparatus membrane; Lipid-anchor.; [Isoform 2]: Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Note=Colocalizes with RACK1 to the perinuclear region.
Target Protein Families
Small GTPase superfamily, Ras family
Target Tissue Specificity
Widely expressed.
Target Synonyms
C BAS/HAS; C HA RAS1; C-BAS/HAS; c-H-ras; C-HA-RAS1; CTLO; GTPase HRas; GTPase KRas; GTPase NRas; H ras; H RASIDX; H-Ras-1; H-RASIDX; Ha-Ras; HAMSV; HRAS; HRAS1; K ras; K RAS2A; K RAS2B; K RAS4A; K RAS4B; K-RAS; KRAS; KRAS1; KRAS2; N-RAS; N-terminally processed; NRAS; NRAS1; p21ras; RASH_HUMAN; RASH1; RASK2; Transforming protein p21; v Ha ras Harvey rat sarcoma viral oncogene homolog; v Ki ras2 Kirsten rat sarcoma viral oncogene homolog; v ras neuroblastoma RAS viral oncogene homolog
Target Background
This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
Notification