-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GluR1/GRIA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GluR1/GRIA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16011A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GluR1/GRIA1 |
| Target Synonyms | GLUH1; GLUR1; GLURA; GluA1; HBGR1; MRD67; MRT76; GluR1/GRIA1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL | Uniprot ID | P42261 |
Uniprot Id
P42261
Target Species
Human
Target Name
GRIA1
Target Full Name
Glutamate receptor 1
Target Function
Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic density membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine. Early endosome membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRIA1 subfamily
Target Tissue Specificity
Widely expressed in brain.
Target Synonyms
GLUR 1; GLUR A; AMPA 1; AMPA selective glutamate receptor 1; AMPA-selective glutamate receptor 1; GluA1; GLUH1; GluR K1; GluR-1; GluR-A; GluR-K1; GLUR1; GLURA; GluRK1; Glutamate receptor 1; Glutamate receptor ionotropic AMPA 1; Glutamate receptor ionotropic; Glutamate receptor; ionotropic; AMPA 1; Gria1; GRIA1_HUMAN; HBGR1; MGC133252; OTTHUMP00000160643; OTTHUMP00000165781; OTTHUMP00000224241; OTTHUMP00000224242; OTTHUMP00000224243
Target Background
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification