-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OGT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 947-1046 of human OGT (O15294) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.
The antibody against OGT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 947-1046 of human OGT (O15294) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.
| Cat.No | ADA-16030A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OGT |
| Target Synonyms | OGT1; HRNT1; MRX106; XLID106; HINCUT-1; O-GLCNAC; OGT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, A549, BxPC-3, Mouse brain, Mouse liver | Application | ELISA, WB, ChIP, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 947-1046 of human OGT (O15294). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA | Uniprot ID | O15294 |
Uniprot Id
O15294
Target Species
Human
Target Name
OGT
Target Full Name
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
Target Function
Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Glycosylates a large and diverse number of proteins including histone H2B, AKT1, EZH2, PFKL, KMT2E/MLL5, MAPT/TAU and HCFC1. Can regulate their cellular processes via cross-talk between glycosylation and phosphorylation or by affecting proteolytic processing. Probably by glycosylating KMT2E/MLL5, stabilizes KMT2E/MLL5 by preventing its ubiquitination. Involved in insulin resistance in muscle and adipocyte cells via glycosylating insulin signaling components and inhibiting the 'Thr-308' phosphorylation of AKT1, enhancing IRS1 phosphorylation and attenuating insulin signaling. Involved in glycolysis regulation by mediating glycosylation of 6-phosphofructokinase PFKL, inhibiting its activity. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. Plays a key role in chromatin structure by mediating O-GlcNAcylation of 'Ser-112' of histone H2B: recruited to CpG-rich transcription start sites of active genes via its interaction with TET proteins (TET1, TET2 or TET3). As part of the NSL complex indirectly involved in acetylation of nucleosomal histone H4 on several lysine residues. O-GlcNAcylation of 'Ser-75' of EZH2 increases its stability, and facilitating the formation of H3K27me3 by the PRC2/EED-EZH2 complex. Regulates circadian oscillation of the clock genes and glucose homeostasis in the liver. Stabilizes clock proteins ARNTL/BMAL1 and CLOCK through O-glycosylation, which prevents their ubiquitination and subsequent degradation. Promotes the CLOCK-ARNTL/BMAL1-mediated transcription of genes in the negative loop of the circadian clock such as PER1/2 and CRY1/2. O-glycosylates HCFC1 and regulates its proteolytic processing and transcriptional activity. Regulates mitochondrial motility in neurons by mediating glycosylation of TRAK1. Glycosylates HOXA1. O-glycosylates FNIP1.; the mitochondrial isoform (mOGT) is cytotoxic and triggers apoptosis in several cell types including INS1, an insulinoma cell line.
Target Involvement
Mental retardation, X-linked 106 (MRX106)
Target Subcellular Location
Nucleus. Cytoplasm.; [Isoform 2]: Mitochondrion. Membrane.; [Isoform 3]: Cytoplasm. Nucleus. Cell membrane. Mitochondrion membrane. Cell projection.; [Isoform 4]: Cytoplasm. Nucleus.
Target Protein Families
Glycosyltransferase 41 family, O-GlcNAc transferase subfamily
Target Tissue Specificity
Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver.
Target Research Area
Neuroscience
Target Synonyms
FLJ23071; GlcNAc transferase; HRNT1; MGC22921; O GlcNAc; O GlcNAc transferase p110 subunit ; O GlcNAc transferase subunit p110; O linked N acetylglucosamine (GlcNAc) transferase (UDP N acetylglucosamine:polypeptide N acetylglucosaminyl transferase); O linked N acetylglucosamine (GlcNAc) transferase; O linked N acetylglucosamine transferase 110 kDa subunit; O-GlcNAc transferase subunit p110; O-linked N-acetylglucosamine transferase 110 kDa subunit; ogt; OGT1_HUMAN; UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit; UDP N acetylglucosamine peptide N acetylglucosaminyltransferase GlcNAc transferase; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase; Uridinediphospho N acetylglucosamine:polypeptide beta N acetylglucosaminyl transferase
Target Background
This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification