-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Arp3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human Arp3 (P61158) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Arp3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human Arp3 (P61158) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16067A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Arp3 |
| Target Synonyms | ARP3; Arp3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Jurkat, Mouse liver, Mouse lung, Mouse spleen, Rat lung, Rat spleen, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 319-418 of human Arp3 (P61158). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS | Uniprot ID | P61158 |
Uniprot Id
P61158
Target Species
Human
Target Name
ACTR3
Target Full Name
Actin-related protein 3
Target Function
ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament. In podocytes, required for the formation of lamellipodia downstream of AVIL and PLCE1 regulation. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs). Plays a role in ciliogenesis.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection. Nucleus. Note=In pre-apoptotic cells, colocalizes with MEFV in large specks (pyroptosomes) (PubMed:19109554).
Target Protein Families
Actin family, ARP3 subfamily
Target Research Area
Immunology
Target Synonyms
ACTR3; ARP3Actin-related protein 3; Actin-like protein 3
Target Background
The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene.
Notification