-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIAS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PIAS2 (NP_004662.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIAS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PIAS2 (NP_004662.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16102A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIAS2 |
| Target Synonyms | DIP; MIZ1; SIZ2; ARIP3; PIASX; ZMIZ4; PIAS2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PIAS2 (NP_004662.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKN | Uniprot ID | O75928 |
Uniprot Id
O75928
Target Species
Human
Target Name
PIAS2
Target Full Name
E3 SUMO-protein ligase PIAS2
Target Function
Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulator in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. The effects of this transcriptional coregulation, transactivation or silencing may vary depending upon the biological context and the PIAS2 isoform studied. However, it seems to be mostly involved in gene silencing. Binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. Isoform PIAS2-beta, but not isoform PIAS2-alpha, promotes MDM2 sumoylation. Isoform PIAS2-alpha promotes PARK7 sumoylation. Isoform PIAS2-beta promotes NCOA2 sumoylation more efficiently than isoform PIAS2-alpha. Isoform PIAS2-alpha sumoylates PML at'Lys-65' and 'Lys-160'.
Target Subcellular Location
Nucleus speckle. Nucleus, PML body. Nucleus.
Target Protein Families
PIAS family
Target Tissue Specificity
Mainly expressed in testis. Isoform 3 is expressed predominantly in adult testis, weakly in pancreas, embryonic testis and sperm, and at very low levels in other organs.
Target Synonyms
Androgen receptor interacting protein 3; Androgen receptor-interacting protein 3; ARIP3; DAB2 interacting protein; DAB2-interacting protein; DIP; E3 SUMO protein ligase PIAS2; E3 SUMO-protein ligase PIAS2; MIZ; Miz1; Msx interacting zinc finger protein; Msx-interacting zinc finger protein; PIAS NY protein; PIAS-NY protein; PIAS2; PIAS2_HUMAN; PIASX; PIASX-ALPHA; PIASX-BETA; Protein inhibitor of activated STAT x; Protein inhibitor of activated STAT, 2; Protein inhibitor of activated STAT2; SIZ2; Zinc finger, MIZ-type containing 4; ZMIZ4
Target Background
This gene encodes a member of the protein inhibitor of activated STAT family, which function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Isoforms of the encoded protein enhance the sumoylation of specific target proteins including the p53 tumor suppressor protein, c-Jun, and the androgen receptor. A pseudogene of this gene is located on the short arm of chromosome 4. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1.
Notification