Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against JunD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human JunD (P17535) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA, CUT&Tag.
The antibody against JunD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human JunD (P17535) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA, CUT&Tag.
| Cat.No | ADA-16128A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | JUND |
| Target Synonyms | AP-1; JunD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-1080 | Application | ELISA, WB, ChIP, CUT&Tag, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human JunD (P17535). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSY | Uniprot ID | P17535 |
Uniprot Id
P17535
Target Species
Human
Target Name
JUND
Target Full Name
Transcription factor JunD
Target Function
Transcription factor binding AP-1 sites.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Jun subfamily
Target Synonyms
Activator protein 1; AP 1; AP1; Jun D; jun D proto oncogene; Jund; JunD FL isoform; JUND_HUMAN; Transcription factor jun D; Transcription factor jun-D
Target Background
The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
